Find01
Find what you need
Discover businesses, skilled professionals, products, and services that match what you're looking for. Every provider is ID-checked and verified before they appear.
Currently available in Lagos, Nigeria. We are expanding to more cities soon, stay tuned!
AutomatingLocalServicesandCommerce
Arvicescombinesaverifiedservicemarketplace,anonlineproductstore,asmartbookingengine,andanAIassistant,allreachablethroughtheweb,themobileapp,orasingleWhatsAppmessage.
Service marketplace
Every Trade You Need,
Already Verified
Browse verified professionals across dozens of categories: plumbing, cleaning, photography, catering, repairs, events and plenty more. Every provider on the list has been identity checked before they were ever allowed to take a job.
Filter by location, price, rating and availability, read reviews left only by clients who actually completed a booking, and look through real portfolios before you commit a single naira.
- Instant availability calendar on every provider
- Competitive bidding so you never overpay
- Verified provider profiles with real portfolios
- Reviews only from clients who completed a job
Plumber in Lekki, Lagos
Verified onlyAvailable todayUnder ₦25,0004.5 and above
TA
Tunde Adeyemi
Plumbing · Lekki Phase 1
4.9128 jobs done
₦18,000
BookAN
Ada Nwosu
Plumbing · Ikoyi
4.894 jobs done
₦22,500
BookCO
Chidi Okafor
Plumbing · Victoria Island
4.761 jobs done
₦15,000
Book142 verified providers nearbySee all
AI agent concierge
Skip the Search.
Let the Agent Do the Asking
Tell the agent what you want and then close the app. It reaches out to every relevant provider on your behalf, passes on the details of the job, and asks them what they can do it for and when they are free.
It does not bargain for you and it does not decide anything. It carries the questions over, carries the answers back, and keeps that going until each provider has given you a straight offer.
Those offers land wherever you actually read things: email, WhatsApp, a push notification, inside Nexus AI, or all of them at once. You step back in only to pick the one you like.
- The agent reaches out to providers for you
- It relays your details and their answers back and forth
- Every offer is collected in one place while you are away
- Delivered by email, WhatsApp, push or Nexus AI
- The choice stays yours, the agent never decides
Your brief
Videographer for a wedding in Lagos on 12 July, budget around ₦250,000
Agent reached out to 14 matching providers
Sent5 providers replied with an offer
CollectedRanked by price, rating and distance
ReadyOffers waiting for you
Bola Adeniyi Films
Best value₦210,000
Frame & Focus Studio
₦245,000
Lens Republic
₦268,000
Email WhatsApp Push Nexus
Accept Nexus AI
Meet Nexus, Ask Anything
and Get Anything Done
Nexus is our built in AI assistant and it is not limited to Arvices. Ask it about cooking, history, coding, travel, or anything else at all. When you are ready to get something done on the platform, it handles the whole flow for you.
Nexus also has an Agent Mode. If a product or service is not available right now, it reaches out to relevant providers on your behalf, collects their offers, and presents them to you. You just pick the best deal.
- Ask any question, about Arvices or about anything else
- Find and compare providers by location and rating
- Book appointments and manage your calendar by chat
- Browse products and place orders without leaving the chat
- Check your wallet balance and transaction history
- Remembers your conversation history across sessions
Nexus
New Chat
2:15 PM
what are some cakes that i can buy
2:20 PMSure David! Here are some cake options you can buy on Arvices:
- • Cake (bbetne) · ₦5,000
- • Coffee Cake (small, medium or large) · ₦15,000
- • Cherry Cake · ₦25,000
- • Chocolate Cake · ₦30,000
Which one should I help you add to your cart, ₦5k, ₦15k, ₦25k, or ₦30k?
🎂
Chocolate Cake
₦30,000
Chocolate Cake
John Paul
9 months agoWhat would you like me to do for you?
Send
Can't find it? Post it.
Service Requests,
Let Providers Come to You
Cannot find the exact service you need? Create a Service Request. We immediately recommend it to the most relevant providers on the platform. If no match accepts, the request opens up to every suitable provider so they can send in their offers.
At the same time, our AI agent proactively reaches out to the providers most likely to be a great fit, so responses arrive faster without you lifting a finger.
- Matched and recommended to the most relevant providers first
- Opens to any provider if no match is found
- Our AI agent contacts suitable providers at the same time
- No back and forth, receive every offer, review, accept the best
01
Describe your need
Tell us what you are looking for, as specific or as vague as you like. Our AI can help you refine the request.
02
We find providers automatically
We recommend your request to the best matched providers. If none accept, it opens to all. Our AI agent also reaches out to suitable providers on your behalf at the same time.
03
Pick the best offer
Review every incoming offer side by side, check each provider's rating and portfolio, then accept the one that fits.
Smart booking
Pick a Slot.
That Is the Whole Booking
Every provider keeps a live calendar, so what you see is what is genuinely free. Choose a date, choose a time, and the booking is confirmed on the spot with no phone calls and no waiting for a reply.
Plans change, so rescheduling and cancelling take one tap each. Reminders go out to both sides ahead of time, and every past booking stays in your history ready to be repeated.
- Live availability, never a double booking
- Reschedule or cancel in one tap
- Automatic reminders for you and the provider
- Full booking history you can rebook from
July 2026
MTWTFSS
0
0
0
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
0
Open slots on 12 July
9:00 AM11:30 AM2:00 PM4:30 PM
AN
Deep cleaning with Ada Nwosu
12 July · 11:30 AM · 3 hours
Product store
Buy Things, Not Just
Hours of Someone's Time
Arvices is a shop as well as a marketplace. Order physical goods from trusted vendors in the same place you hire your electrician, using the same wallet and the same checkout.
Our AI reads what you actually asked for rather than matching keywords, so describing a vague idea like something nice for a housewarming still surfaces the right shelf.
- AI enhanced product search that understands plain language
- Cart and secure checkout backed by your wallet
- Order tracking from packed to delivered
- Vendors and service providers under one account
Something nice for a housewarming AI picks
🎂
Chocolate Cake
₦30,000
🪑
Accent Armchair
₦86,000
🎧
Studio Headset
₦42,500
🕯️
Scented Candle Set
₦9,800
3 items in cart
₦82,300
Order ARV-48120
Packed
Shipped
Out for delivery
4
Delivered Real time messaging
Talk It Through
Without Leaving Arvices
Chat directly with your provider before, during and after the job. Share photos of the broken tap, agree on the details, and send the address, all inside the booking it belongs to.
No swapping phone numbers and no third party apps, which also means the whole conversation stays on record if anything is ever disputed.
- Instant notifications on web, mobile and push
- File and image sharing inside the thread
- Message history tied to each booking
- Nothing leaves the platform, so nothing gets lost
AN
Ada Nwosu
Online now
Hi Ada, can you come by around 11:30 on Saturday?
That works. Sending you a photo of the last kitchen I finished so you know what to expect.
Write a message
Wallet and payments
One Balance for
Everything You Spend
Fund your Arvices wallet once and use it for bookings, products and deliveries. Every payment, refund and payout lands in one ledger you can actually read.
Money for a job sits in escrow until the work is done, which protects you from paying for nothing and protects the provider from finishing for nothing. Payouts reach providers instantly and can be withdrawn to a bank account anytime.
- Multiple payment methods, one balance
- Escrow holds funds until the job is complete
- Full transaction history with running balance
- Instant provider payouts and withdrawals on demand
Arvices wallet
₦128,400.00
₦25,000 held in escrow on 1 active job
Add money Withdraw
Recent transactions
Wallet funded via card
Today · 9:14 AM
+₦50,000
Paid Ada Nwosu
Yesterday · 4:02 PM
₦22,500
Escrow held for booking #4821
12 July · 11:30 AM
₦25,000
Refund from cancelled order
10 July · 6:45 PM
+₦9,800
Showcase feed
See the Work
Before You Hire Anyone
The showcase feed is a social style stream of finished work from providers near you. Photos and video of real jobs, posted by the people who did them, with comments and questions from clients who have used them.
Follow the providers you like, bookmark work you want to reference later, and hire straight from a post the moment something catches your eye.
- Photo and video portfolios of completed jobs
- Trending, following and nearby tabs
- Share, bookmark and comment on work
- Hire directly from any post
TrendingFollowingNearby Live
BA
Bola Adeniyi
Interior finishing · 2 hours ago
+6
Finished this three bedroom in Magodo last week. Full ceiling rework, wall panelling and lighting.
412 58 3.1k
Spotlight
What Is Worth
a Look Right Now
Spotlight is the band of cards that runs across the home page and the provider feeds. It is where the things worth knowing right now live: a promotion while it is still running, a price drop on something you had your eye on, a provider who has just joined your area, an event coming up, or a fresh piece on the blog.
Every card in it is chosen and designed by hand rather than pulled from a feed, so it stays short and it stays current. On a quiet week, when there is nothing worth saying, the band is simply not there.
- Promotions and price drops while they are still on
- New providers as they arrive in your area
- Events, product launches and fresh blog posts
- Chosen and designed by hand, never an automated feed
- On the home page and across the provider feeds
Spotlight2 / 5
DoneWeekend promo
20% off every deep clean
Booked through Arvices until Sunday
Open
Poster
Price drop
New provider
Event
Callback hiring
Liked Their Work?
Hire Them Again Instantly
When you find a provider you trust, you should not have to search all over again. Callback Hiring lets you rehire anyone from your job history, for the same service or a completely different one, with a single tap.
It benefits the provider too. The more clients call someone back, the more Arvices recognises that quality, pushing them higher in search results and in AI recommendations for new jobs across the platform.
- Rehire from your job history with no searching
- Works for any service type, not just the original job
- Callback count feeds provider recommendation ranking
- Providers with high callbacks are surfaced first by the AI
Your completed jobs
AN
Ada Nwosu
Deep cleaning · March
TA
Tunde Adeyemi
Kitchen plumbing · January
BA
Bola Adeniyi
Ceiling rework · December
Ada's callback score
Recommended first24
callbacks in the last 90 days
Top 8% of providers in her category
WhatsApp automation
Use Arvices Without
Opening the App
We connected our AI directly to WhatsApp. Hire a plumber, order products, check your wallet, or post a service request from the messaging app already sitting on your phone. No download and no login needed to get started.
- Available 24/7, no waiting
- Full access to the marketplace from WhatsApp
- Secure payment and booking confirmations sent directly
- Works for services, products, bookings and account queries
Arvices AI
WhatsApp · Typically replies instantly
Find me a photographer in Lagos for next weekend✓✓
Found several photographers available in Lagos. Top pick: Tunde Adeyemi, 4.9 stars, ₦25,000 per session. Want me to check availability?
Book the cheapest electrician near Ikeja✓✓
Done! Booked Chidi Okafor for tomorrow at 10am. Confirmation sent to your email.
What's my wallet balance?✓✓
Your current Arvices wallet balance is ₦12,500.00. Last transaction: ₦3,000 on May 7.
Type a message…
Voice agent
Say It Out Loud,
Nexus Does the Rest
Press the orb and talk. Nexus hears you, answers out loud, and picks up the same conversation you were typing in, so there is nothing to repeat.
It is not a dictation box. While you are still talking it works the app for you: opening a page, filtering a list, dropping providers on a map, pressing the button you are looking at. Interrupt it whenever you like.
Choose the voice, the pace and the language it speaks: English, Yoruba, Hausa and a dozen more, translated before it is said out loud.
- Talk instead of typing, on the same Nexus conversation
- It opens pages, filters lists and shows maps as you speak
- Speaks English, Yoruba, Hausa and more
- Interrupt at any point, it stops and listens
- Anything that spends money asks you out loud first
- Hangs up on its own when you are done, so nothing is left running
Listening, go ahead
Rachel · English
End call
Find me a cleaner in Lekki and show them on the map
Twelve nearby. That is them on the map now. The closest is Ada Nwosu, 4.8 stars, ₦22,500.
Book her for Saturday at 11:30
Opened Providers Filtered to Lekki Switched to map Opened booking
Waiting on you
Book Ada Nwosu · Saturday 11:30 · ₦22,500
Voice
Rachel
Language
English
Pace
1.0×
Expressiveness
Balanced
Store page
Every Provider Gets
a Website of Their Own
Every provider on Arvices has a full website living at their own address, arvices.com/theirname. It is the kind of online shopfront a business would normally pay a designer to build, and it opens their whole catalogue in one link: services, products, finished work and the reviews clients left behind.
And you can have it on your own name. Search for a domain right here — yourbrand.com, yourbrand.ng, yourbrand.com.ng — buy it in the builder, and we do the rest: registered in your name, pointed at your site, and secured with HTTPS, with no DNS settings to work out and nothing to set up anywhere else. It goes live the moment you press publish, and both yourbrand.com and www.yourbrand.com open your shop. Already own a domain from somewhere else? Connect that instead and keep it exactly where it is — we show you the two records to add and check them for you.
You decide how much of it you build. Leave it alone and the page assembles itself from what you have already listed: your photo sets the color the store is themed in, every service and product becomes its own full screen section, and showcases and reviews fall in underneath. Sections appear only when there is something to put in them, so no two stores look alike and the more you add the fuller yours gets.
Want it your way instead? Open the store builder and design it yourself, section by section, choosing the layout, the order and the colors. Or say what you have in mind in one sentence and let our AI build the whole store for you, then keep whatever it picked and change the rest. Both doors lead to the same page, so you can start with the AI and finish by hand.
For shoppers it is the easiest way to size someone up. Open a provider's store, browse it as a compact grid or one item per screen, and book or buy without leaving the page.
- A website at your own address, arvices.com/yourbrand, free
- Buy your own domain here — .com, .ng, .com.ng and more
- We register it, point it and secure it. No DNS to configure
- Or connect a domain you already own and keep it where it is
- Free HTTPS, renewed automatically, on every domain
- Design it yourself in the builder, or describe it and let our AI build it
- Themed automatically from your profile photo
- Showcases and client reviews built into the page
- Share the link anywhere: bio, status, business card, flyer
arvices.com/bola.interiors Share
BA
Bola Interiors
Interior finishing · Lekki, Lagos
ServicesProductsShowcasesReviews
Ceiling rework
₦145,000
Wall panelling
₦92,000
Lighting set
₦38,500
Discovery and channels
Found on Google, and in
ChatGPT, Claude and Perplexity.
Nothing you list on Arvices is trapped inside an app. You, your store, every service and every product is published as a real web page with its own address, its own description, and machine readable markup spelling out the price, the rating, the availability and the area you cover.
Google indexes that. So do the crawlers behind ChatGPT, Claude, Perplexity, Gemini and Copilot, which are named and allowed in by robots.txt and handed a plain text inventory of the marketplace so they can read you without running a line of JavaScript. Those crawlers do not execute scripts, which is why the pages are pre-rendered for them rather than left to load in a browser nobody is driving.
So one listing, written once, works for a search box and for whoever is asking an assistant to recommend somebody, with your store as the cited source. The same catalogue then sells wherever your buyers already are: Nexus AI offers it when a client asks for your trade, WhatsApp answers for you, and your storefront link drops into a bio or a status.
- A real, indexable page for you, your store, each service and each product
- Structured data for price, rating, availability and service area
- Named and allowed in for GPTBot, ClaudeBot, PerplexityBot and Google-Extended
- A plain text inventory so assistants can read you without running JavaScript
- Sold through Nexus AI and on WhatsApp as well as on your store
- One catalogue: update it once, and every channel updates with it
generator repair near surulere
arvices.com › chidi.power
Chidi Power Systems — generator repair in Surulere, Lagos
4.894 reviews·callout from ₦12,000
Verified engineer. Servicing, rewinding, inverter installs. Same-day slots, paid into escrow.
Asked an AI assistant
“For a generator in Surulere, Chidi Power Systems takes same-day callouts through Arvices — 4.8 across 94 reviews, from ₦12,000.”
Source: arvices.com/chidi.power
Nexus AI
WhatsApp
Social
Your store
Business tools
Everything You Need to Run It,
Already in Your Account
Arvices is not only where the work comes from. Every account also comes with the tools for the work around the work: the flyer for tomorrow, the voiceover for a reel, the quote you have to send as a PDF, the note you took at a site visit. They all sit inside Nexus, they open beside the conversation you are already having, and everything you make is saved to your library.
Creative Studio
Posts, flyers and ads built from your real services and products. Describe the promo you want and it lays the whole thing out using your own prices, photos and brand colors.
Audio studio
Write a script, pick a voice, and get a clean recording back. Trim it, cut it and export it for a reel, an advert or a voice note to a client.
Video studio
Generate shots, lay them on a timeline, add captions and music, then render the film. Built for short promos you can post the same day.
Document studio
Quotes, invoices, proposals and reports written on screen and exported as PDF, Word or slides, ready to send.
Notes
Keep your business information, ideas, client details, and plans in one simple place. Start writing instantly, everything saves automatically, and search finds what’s inside your notes. Attach files when needed, then let Nexus turn your notes into documents, quotes, proposals, and more.
Storefront builder
Design your website section by section, or describe the shop you have in mind and let our AI build it for you, then change anything it picked.
Your own domain
Search for yourbrand.com right inside the builder and buy it in a couple of taps — we register it, point it at your site and secure it with HTTPS, with no DNS to configure. Already own one? Connect it instead and keep it where it is.
Media library
Everything you have made or uploaded, in one place, ready to reuse in the next design, share as a link or download.
More tools are on the way
We are building the next set right now such as the customer hub and business agent, and we are not going to make you go looking for them. The moment a new tool lands it appears in your Nexus sidebar and you get a notification on your account, so you will know the day it is ready to use.
How Arvices
Works.
For clients
01 / 06
For businesses & professionals
01 / 06
Safety first
Built on Trust and
Verification
Every provider on Arvices goes through an approval process. You see verified credentials, real reviews, and an honest showcase of past work before you spend a single naira.
ID Verification
Every provider is identity checked before approval.
Real Reviews
Only clients who completed a booking can leave a review.
Escrow Payments
Funds are held securely until the job is done.
Job Tracking
Monitor every booking, order, and delivery in real time.
Verified Providers
Identity checked and approved
Rated by Real Clients
Honest, verified reviews
Multiple Categories
From repairs to events
Secure Transactions
Bank level encryption
24/7 AI Support
Ask anything, anytime
WhatsApp Access
No app needed
Currently available in Lagos
The smarter way to get
services done.
Join people already using Arvices to automate their service needs on the web, on mobile, or on WhatsApp.